PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00676.1.g00120.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 881aa    MW: 94255.4 Da    PI: 9.0911
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00676.1.g00120.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.71.3e-20380435156
                                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   +++ +++t++q++eLe++F+++++p++++r eL+k+l+L+ +qVk+WFqNrR+++k
  Zpz_sc00676.1.g00120.1.am.mk 380 KKRYHRHTPQQIQELEAVFKECPHPDEKQRMELSKRLNLEIQQVKFWFQNRRTQMK 435
                                   688999***********************************************999 PP

2START1142.2e-365927824165
                                   HHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-T CS
                         START   4 eeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWde 74 
                                   ++a++elvk+ + ++p+W   +     + +n de+ + f++  +     + +ea r+ gvv+  +++lv +l+d + +W+e
  Zpz_sc00676.1.g00120.1.am.mk 592 LAAMEELVKLSQMDAPLWLPGPdgsgfDTLNLDEYHRAFARVFGpsldgYVSEATREAGVVISSSVDLVDSLMDAS-RWSE 671
                                   789************************************77555********************************.**** PP

                                   T-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE.........-TTS CS
                         START  75 tla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvd.........seqk 135
                                   +++    +a+t++ issg      g +qlm aelq+lsplvp R+ vf+R+++q+ +g+w+++dvSvd         + q+
  Zpz_sc00676.1.g00120.1.am.mk 672 MFPcivaRASTTDIISSGmggtrsGSIQLMHAELQVLSPLVPiREMVFLRFCKQHADGVWAVADVSVDailrpdghhHSQH 752
                                   *******************************************************************95555555434444 PP

                                   --.-TTSEE-EESSEEEEEEEECTCEEEEE CS
                         START 136 ppesssvvRaellpSgiliepksnghskvt 165
                                   +   ++++ ++llpSg++++++ ng+sk +
  Zpz_sc00676.1.g00120.1.am.mk 753 NGGAAGYMGCRLLPSGCIVQDMNNGYSKRH 782
                                   44499**********************966 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.63E-21362437IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-22367437IPR009057Homeodomain-like
PROSITE profilePS5007117.864377437IPR001356Homeobox domain
SMARTSM003891.6E-19378441IPR001356Homeobox domain
PfamPF000463.8E-18380435IPR001356Homeobox domain
CDDcd000862.27E-19380437No hitNo description
PROSITE patternPS000270412435IPR017970Homeobox, conserved site
PROSITE profilePS5084829.186580780IPR002913START domain
CDDcd088752.61E-80584783No hitNo description
SuperFamilySSF559613.66E-18584782No hitNo description
SMARTSM002346.0E-18589841IPR002913START domain
PfamPF018521.4E-28592782IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 881 aa     Download sequence    Send to blast
MLRATTHFAR DESTRPSRAF GLDWVARRVG RHGTGAAAWL RWVGAVRQYP CLLLRSHGTT  60
SVLRQTPAKP PPLPRTTCRT FRRSLSPIPR AFVPPVRSRC RGRFSCLQTS FLHLPLRFAV  120
VLALLHTGRR CWSPVKLICH CQICDGVKVS NRAAAAGIPR PRPMQACSGT LHPSGGGQDP  180
FDSRRPSSGS APLLVDDSSH VPGLPALSTC LLLPAIAPVG LPSWVPPSFF FVLSYFGSLI  240
FVRRARRAAG EVVVFSMSFG GGMFDGAGAG VFSYDASGGG AGTHNPGLLS AAPPVAEHGA  300
GGFASPGLSL GLQTNMDGGQ LGDVSRLGLM GSGGNGSVGD GDSMGRGRDD ENDSRSGSDN  360
LDGASGDELD PDNSNPRKKK KRYHRHTPQQ IQELEAVFKE CPHPDEKQRM ELSKRLNLEI  420
QQVKFWFQNR RTQMKTQIER HENALLRQEN DKLRADNMTI REAVRNPTCG TCGGAAVLGE  480
VSLEEQHLRI ENARLKDELD RVCAIAGKFL GRPVSFGSPV SSLQGCSGLG LGVGANGFGL  540
GLLGASSLPP IPDLMGSSSA LRLPAGIGGF DGAMHGGAAD GVDRAVLLEL GLAAMEELVK  600
LSQMDAPLWL PGPDGSGFDT LNLDEYHRAF ARVFGPSLDG YVSEATREAG VVISSSVDLV  660
DSLMDASRWS EMFPCIVARA STTDIISSGM GGTRSGSIQL MHAELQVLSP LVPIREMVFL  720
RFCKQHADGV WAVADVSVDA ILRPDGHHHS QHNGGAAGYM GCRLLPSGCI VQDMNNGYSK  780
RHVAATVRKL SAHLGRAQLS TRSCGAACGG HSAQVKRAFR TRTAQHSFVW RYAVLPRSCA  840
SCHSWVAGTL IRGPPQASCA RHPLRDVRVS EDQLVFVPAA F
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1376381RKKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105125.10.0outer cell layer 3
SwissprotQ7Y0V70.0ROC6_ORYSJ; Homeobox-leucine zipper protein ROC6
TrEMBLQ9LEE80.0Q9LEE8_MAIZE; OCL3 protein
STRINGGRMZM2G116658_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.11e-150homeodomain GLABROUS 1